PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_14976
Common NameKK1_015413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 504aa    MW: 55803.3 Da    PI: 5.1914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_14976genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-173481148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++v+++G g+W+++ ++ g+ R++k+c++rw ++l
    C.cajan_14976 34 KGPWTSAEDAILVNYVNKHGEGNWNAVQKYSGLSRCGKSCRLRWANHL 81
                     79******************************************9986 PP

2Myb_DNA-binding491.4e-1587130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+ l++++++++G++ W++ a++++ gRt++++k++w++
    C.cajan_14976  87 KGAFTAQEERLIAELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 130
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3012981IPR017930Myb domain
SuperFamilySSF466894.49E-3033128IPR009057Homeodomain-like
SMARTSM007175.9E-153383IPR001005SANT/Myb domain
PfamPF002491.8E-153481IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-233588IPR009057Homeodomain-like
CDDcd001673.15E-113681No hitNo description
PROSITE profilePS5129424.23182136IPR017930Myb domain
SMARTSM007179.3E-1686134IPR001005SANT/Myb domain
PfamPF002499.6E-1587130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2489135IPR009057Homeodomain-like
CDDcd001673.83E-1189130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MSQMTNEVDD NVHRNDQTRS QLNDEGNGDV VLKKGPWTSA EDAILVNYVN KHGEGNWNAV  60
QKYSGLSRCG KSCRLRWANH LRPNLKKGAF TAQEERLIAE LHAKMGNKWA RMAAHLPGRT  120
DNEIKNYWNT RIKRRQRAGL PLYPPEVFLQ AFKESKHGQG TSGISDGDNR HQDFLDKNNY  180
EIHDAVFDSL KENQGILPYV PELPNISANS ILPNGLGSPP YCNFVPSTLP NHLRESTMSF  240
LGSSGLSRNE FYPFDHIKDN TSDKIADSFG LHSPLDRGAS SHGSICYSHS LSNGNSSTSK  300
LTTEAVKSEL PSLQYPETEF GSWGTSPPPP LNESADVFIH SQPPNALDSG CSSPHNSGLL  360
DALVYQAKTL SSKNNCSDKS SNSSVATPGD IAESSALNMY ATEWEDYADP VSPFCATSIL  420
NECPAVSTNG NSWDEWESFQ TITGNNNVKM QSVDQVWAPK SENQYMSNLT WPDVLLTSEW  480
HDLYSENGVN QTIMTDASDD FSRQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29321355107B-MYB
1mse_C3e-29311351104C-Myb DNA-Binding Domain
1msf_C3e-29311351104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1871650.0AC187165.17 Glycine max cultivar Williams 82 clone gmw2-91b16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003523913.10.0PREDICTED: transcription factor GAMYB-like isoform X2
TrEMBLA0A151SYT50.0A0A151SYT5_CAJCA; Transcription factor GAMYB
STRINGGLYMA04G15150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-104myb domain protein 65